PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007274P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 254aa    MW: 27727.6 Da    PI: 9.706
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007274P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.9e-392379561
          zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                    +lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+ 
  MELO3C007274P1 23 TLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRL 79
                    689***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-281578IPR003851Zinc finger, Dof-type
PfamPF027019.3E-342378IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5252478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MASSSRIMDK PRHHQQQQSS SGTLKCPRCD SSNTKFCYYN NYSLSQPRHF CKACKRYWTR  60
GGTLRNVPVG GGCRKNKRLK TSSSSSSSSL VNANSTSTPS QNPRLLLHTS INSTTAPNIV  120
SSSALNHTNS SMFFGLDSIG GGGGGLGFSS SGLLSHFNNP HQQPFNSNHF HHPTISFDRN  180
SHLLGNIDPN LMTSMKEIKI EDLNRLCQNQ TEQIDLSNFS DPSSIYWNSG TTTATGNWHD  240
PTNYNGSSVA SLF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008439843.10.0PREDICTED: dof zinc finger protein DOF1.7-like
TrEMBLA0A0A0KI371e-145A0A0A0KI37_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.23e-35Dof family protein